Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfotransferase 1B1/SULT1B1 (N-6His)

Source: E. coli. MW :36.3kD. Recombinant Human Sulfotransferase 1B1 is produced by our E.coli expression system and the target gene encoding Met1-Ile296 is expressed with a 6His tag at the N-terminus. Sulfotransferase Family Cytosolic 1B Member 1 (SULT1B1) is a cytosolic enzyme that belongs to the Sulfotransferase 1 family. Human SULT1B1 is a 296 amino acid protein that is highly expressed in the liver, peripheral blood leukocytes, colon, small intestine, and spleen. SULT1B1 utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor, and it can catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds.

Product Specifications

Gene Name

SULT1B1

Gene ID

27284

UniProt

O43704

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 0.1M NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKRKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MED6 Overexpression Lysate (Native) - (Dry Ice)
NBL1-12993 0.1 mg

MED6 Overexpression Lysate (Native) - (Dry Ice)

Ask
View Details
Mouse/Rat Leptin Recombinant Rabbit Monoclonal Antibody [PSH08-94] - BSA and Azide free (Capture)
HA723046 100 µL

Mouse/Rat Leptin Recombinant Rabbit Monoclonal Antibody [PSH08-94] - BSA and Azide free (Capture)

Ask
View Details
CD11b Antibody / MAC-1
V7888-100UG 100 µg

CD11b Antibody / MAC-1

Ask
View Details
Mouse Monoclonal HABP1/C1QBP/GC1q R Antibody (1G7) [DyLight 755]
NBP2-42691IR 100 µL

Mouse Monoclonal HABP1/C1QBP/GC1q R Antibody (1G7) [DyLight 755]

Ask
View Details
RGD1305464 (NM_001025011) Rat Tagged Lenti ORF Clone
RR215589L4 10 µg

RGD1305464 (NM_001025011) Rat Tagged Lenti ORF Clone

Ask
View Details