Recombinant Human BNIP3/NIP3 (N-6His)

Source: E. coli. MW :20.6kD. Recombinant Human BNIP3 is produced by our E.coli expression system and the target gene encoding Met1-Leu166 is expressed with a 6His tag at the N-terminus. BCL2/Adenovirus E1B 19 kDa Protein-Iinteracting Protein 3 (BNIP3) is a single-pass membrane protein. BNIP3 is a member of the NIP3 family. BNIP3 contains a single Bcl-2 homology 3 domain and interacts with the E1B 19 kDa protein. BNIP3 have been associated with pro-apoptotic function. BNIP3 is an apoptosis-inducing protein that can overcome BCL2 suppression. It plays a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2. BNIP3 involved in mitochondrial quality control via its interaction with SPATA18/MIEAP, response to mitochondrial damage, participates to mitochondrial protein catabolic process.

Product Specifications

Gene Name

BNIP3

Gene ID

664

UniProt

Q12983

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLLSRPAV