Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfotransferase 4A1/SULT4A1

Source: E. coli. MW :33kD. Recombinant Human Sulfotransferase 4A1 is produced by our E.coli expression system and the target gene encoding Met1-Leu284 is expressed. Sulfotransferase 4A1 (ST4A1) is a member of the Sulfotransferase 1 family. ST4A1 is highly expressed in the cerebral cortex and frontal lobe, but no expression is detected in the pancreas. ST4A1 is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. ST4A1 acts on catecholamines and T4 in a manner that may not involve sulfonation. ST4A1 may have a role in the metabolism of drugs and neurotransmitters in the CNS. In addition, ST4A1 is related to schizophrenia.

Product Specifications

Gene Name

SULT4A1

Gene ID

25830

UniProt

Q9BR01

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCSAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL
More Discoveries

Explore Other Products

Browse additional items from our catalog

DBIL5P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV759791 1.0 µg DNA

DBIL5P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Anserini CD147/EMMPRIN ELISA Kit
EAE0043 96 Tests

Anserini CD147/EMMPRIN ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal TLR5 Antibody (85B152.5) [DyLight 594]
NBP1-97728DL594 0.1 mL

Mouse Monoclonal TLR5 Antibody (85B152.5) [DyLight 594]

Sign In for Pricing
View Details
Recombinant Human Transmembrane protein 74 (TMEM74), partial
MBS7057873 Inquire

Recombinant Human Transmembrane protein 74 (TMEM74), partial

Sign In for Pricing
View Details
Mouse Dusp1 Pre-designed siRNA Set B
SI103953B 1 Each

Mouse Dusp1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Engrailed 1 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-62208R-BF680 100 µL

Engrailed 1 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details