Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C1QBP/HABP1 (C-6His)

Source: E. coli. MW :24.9kD. Recombinant Human Hyaluronic Acid-binding Protein is produced by our E.coli expression system and the target gene encoding Leu74-Gln282 is expressed with a 6His tag at the C-terminus. Complement Component 1Q Subcomponent-Binding Protein (C1QBP) is a nucleus protein that belongs to the MAM33 family. C1QBP is known to bind to the globular heads of C1q molecules and inhibit C1 activation. Mitochondrial C1QBP is a critical mediator of p14ARF-induced apoptosis. C1QBP functions as a chemotactic factor for immature dendritic cells, and migration is mediated through ligation of both C1QBP and cC1qR/CR. C1QBP overexpression successfully blocks mRNA accumulation from the adenovirus major late transcription unit (MLTU) and stimulates RNA polymerase II carboxy-terminal domain phosphorylation in virus-infected cells.

Product Specifications

Gene Name

C1QBP

Gene ID

708

UniProt

Q07021

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 20% Glycerol, 1mM DTT, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQLEHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1230 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7431202 1.0 µg DNA

Olr1230 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
K252a 10mg
A13897-10 10 mg

K252a 10mg

Sign In for Pricing
View Details
TYW5 Antibody
OC-375-01 50 μL

TYW5 Antibody

Sign In for Pricing
View Details
TYW5 Antibody
OC-375-02 100 µL

TYW5 Antibody

Sign In for Pricing
View Details
TYW5 Antibody
OC-375-03 1 mL

TYW5 Antibody

Sign In for Pricing
View Details
RAB11B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV674728 1.0 µg DNA

RAB11B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details