Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C1QBP/HABP1 (C-6His)

Source: E. coli. MW :24.9kD. Recombinant Human Hyaluronic Acid-binding Protein is produced by our E.coli expression system and the target gene encoding Leu74-Gln282 is expressed with a 6His tag at the C-terminus. Complement Component 1Q Subcomponent-Binding Protein (C1QBP) is a nucleus protein that belongs to the MAM33 family. C1QBP is known to bind to the globular heads of C1q molecules and inhibit C1 activation. Mitochondrial C1QBP is a critical mediator of p14ARF-induced apoptosis. C1QBP functions as a chemotactic factor for immature dendritic cells, and migration is mediated through ligation of both C1QBP and cC1qR/CR. C1QBP overexpression successfully blocks mRNA accumulation from the adenovirus major late transcription unit (MLTU) and stimulates RNA polymerase II carboxy-terminal domain phosphorylation in virus-infected cells.

Product Specifications

Gene Name

C1QBP

Gene ID

708

UniProt

Q07021

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 20% Glycerol, 1mM DTT, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Pcsk6 (NM_011048) Mouse Untagged Clone
MC222828 10 µg

Pcsk6 (NM_011048) Mouse Untagged Clone

Ask
View Details
ERP29 Knockout NCI-H1975 Polyclonal Cells
ARG17237 1 Million

ERP29 Knockout NCI-H1975 Polyclonal Cells

Ask
View Details
Influenza A virus/Flu-A Monoclonal Antibody
E55A11362 100 µL

Influenza A virus/Flu-A Monoclonal Antibody

Ask
View Details
Mouse Monoclonal EpCAM/TROP1 Antibody (EGP40/1120) [FITC]
NBP2-47874F 0.1 mL

Mouse Monoclonal EpCAM/TROP1 Antibody (EGP40/1120) [FITC]

Ask
View Details