Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uridine Phosphorylase 1/UPP1 (N-6His)

Source: E. coli. MW :21.3kD. Recombinant Human Uridine Phosphorylase 1 is produced by our E.coli expression system and the target gene encoding Met1-Ala173 is expressed with a 6His tag at the N-terminus. Uridinephosphorylase 1 (UPP1) is a member of the family of pentosyltransferase. UPP1 catalyses the reversible phosphorolysis of uridine to uracil. The expression levels and the enzymatic activity of UPP1 are higher in human solid tumors than in adjacent normal tissues. The high level of UPP1 expression in some tumors makes it a potential prognosticfactor for some cancers, such as oral squamous cell carcinoma. UPP1 is important for the homeostatic regulation of intracellular and plasma uridine concentratios. UPP1 plays an important role in the pyrimidine salvage pathway through its catalysis of the reversible phosphorolysis of uridine to uracil.

Product Specifications

Gene ID

7378

UniProt

Q86Y75

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 200mM NaCl, 1mM DTT, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMQRKLKVTSLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSKA
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SGK071 (Probable Inactive Protein Kinase-like Protein SgK071, Sugen Kinase 071, C9orf96, MGC43306) (PE)
133260-PE 100 µL

SGK071 (Probable Inactive Protein Kinase-like Protein SgK071, Sugen Kinase 071, C9orf96, MGC43306) (PE)

Ask
View Details
Human Cytochrome P450 19A1, CYP19A1 ELISA KIT
ELI-06734h 96 Tests

Human Cytochrome P450 19A1, CYP19A1 ELISA KIT

Ask
View Details
ZSWIM3 antibody
70R-3646 50 ug

ZSWIM3 antibody

Ask
View Details
STPG2 (NM_174952) Human Tagged Lenti ORF Clone
RC207844L3 10 µg

STPG2 (NM_174952) Human Tagged Lenti ORF Clone

Ask
View Details
NDRG4 (NM_001242835) Human Untagged Clone
SC331893 10 µg

NDRG4 (NM_001242835) Human Untagged Clone

Ask
View Details