Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human gamma-Synuclein/SNCG

Source: E. coli. MW :13.6kD. Recombinant Human Gamma-Synuclein is produced by our E.coli expression system and the target gene encoding Met1-Asp127 is expressed. Gamma-Synuclein (SNCG) is a member of the Synuclein protein family. Gamma-Synuclein is mostly expressed in the peripheral nervous system and retina. Gamma-Synuclein plays a role in neurofilament network integrity and may be involved in modulating axonal architecture during development and in the adult. In addition, it may also function in modulating the keratin network in skin. SNCG expression in breast tumors has been as a marker for tumor progression. SNCG is also believed to be involved in the pathogenesis of neurodegenerative diseases.

Product Specifications

Gene Name

SNCG

Gene ID

6623

UniProt

O76070

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GSHMDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Acrylate-PEG-Maleimide, 1K
HE009022-1K-01 1 g

Acrylate-PEG-Maleimide, 1K

Ask
View Details
Acrylate-PEG-Maleimide, 1K
HE009022-1K-02 5 g

Acrylate-PEG-Maleimide, 1K

Ask
View Details
Human Calpain, Small Subunit 1 (CAPNS1) ELISA Kit
EKN43999 96 Tests

Human Calpain, Small Subunit 1 (CAPNS1) ELISA Kit

Ask
View Details
SIRT5 Inhibitor 6
MBS5820464 Inquire

SIRT5 Inhibitor 6

Ask
View Details
Human ZNF649 Protein Lysate
MBS8430338-01 0.02 mg

Human ZNF649 Protein Lysate

Ask
View Details
Human ZNF649 Protein Lysate
MBS8430338-02 5x 0.02 mg

Human ZNF649 Protein Lysate

Ask
View Details