Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Astrocytic Phosphoprotein PEA-15/PEA15

Source: E. coli. MW :15.3kD. Recombinant Human Astrocytic Phosphoprotein PEA-15 is produced by our E.coli expression system and the target gene encoding Met1-Ala130 is expressed. Astrocyticphosphoprotein PEA-15 (PEA15) is a death effector domain (DED) -containing protein. PEA15 is mainly expressed in the central nervous system, principally in astrocytes. Increased PEA15 levels affect tumorigenesis and cancer progression. PEA15 is overexpressed in breast cancers and gliomas as well as in type 2 diabetes. PEA15 blocks Ras-mediated inhibition of integrin activation and modulates the ERK MAP kinase cascade. PEA15 also inhibits RPS6KA3 activities by holding it in the cytoplasm. In addition, PEA15 inhibits both TNFRSF6 and TNFRSF1A mediated CASP8 activity and apoptosis. At present, PEA15 expression is also a significant prognostic marker in ovarian cancer.

Product Specifications

Gene Name

PEA15

Gene ID

8682

UniProt

Q15121

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GSHMAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human SIGLEC8/SAF-2 Antibody , PE
E55A10887 50 Tests

Human SIGLEC8/SAF-2 Antibody , PE

Ask
View Details
Recombinant Cynomolgus ERBB2, His-tagged
MK0311C 10 µg

Recombinant Cynomolgus ERBB2, His-tagged

Ask
View Details
FGFR4 Protein (N-GST, Human)
P524695 100 µg

FGFR4 Protein (N-GST, Human)

Ask
View Details
Human MIR6769A qPCR Primer Pair
QH87125S 200 Tests

Human MIR6769A qPCR Primer Pair

Ask
View Details
PVRL1 (CD111, Poliovirus Receptor-related Protein 1, Herpes Virus Entry Mediator C, Herpes virus Entry Mediator C, HveC, Herpes virus Ig-like Receptor, HIgR, Nectin-1, HVEC, PRR1)
132103 50 µg

PVRL1 (CD111, Poliovirus Receptor-related Protein 1, Herpes Virus Entry Mediator C, Herpes virus Entry Mediator C, HveC, Herpes virus Ig-like Receptor, HIgR, Nectin-1, HVEC, PRR1)

Ask
View Details