Recombinant Human Astrocytic Phosphoprotein PEA-15/PEA15
Source: E. coli. MW :15.3kD. Recombinant Human Astrocytic Phosphoprotein PEA-15 is produced by our E.coli expression system and the target gene encoding Met1-Ala130 is expressed. Astrocyticphosphoprotein PEA-15 (PEA15) is a death effector domain (DED) -containing protein. PEA15 is mainly expressed in the central nervous system, principally in astrocytes. Increased PEA15 levels affect tumorigenesis and cancer progression. PEA15 is overexpressed in breast cancers and gliomas as well as in type 2 diabetes. PEA15 blocks Ras-mediated inhibition of integrin activation and modulates the ERK MAP kinase cascade. PEA15 also inhibits RPS6KA3 activities by holding it in the cytoplasm. In addition, PEA15 inhibits both TNFRSF6 and TNFRSF1A mediated CASP8 activity and apoptosis. At present, PEA15 expression is also a significant prognostic marker in ovarian cancer.
Product Specifications
Gene Name
PEA15
Gene ID
8682
UniProt
Q15121
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
GSHMAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items