Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-3/IL-3 (N-6His)

Source: E. coli. MW :16.6kD. Recombinant Human Interleukin-3 is produced by our E.coli expression system and the target gene encoding Ala20-Phe152 is expressed with a 6His tag at the N-terminus. Interleukin-3 (IL-3) is a potent growth promoting cytokine. IL-3 can stimulate the proliferation and differentiation of pluripotent hematopoietic stem cells as well as various lineage committed progenitors. IL-3 exerts its biological function through binding to specific cell surface receptors. The amino acid sequences of this protein among different species share relatively low identity and its activity is highly species-specific. IL-3 has also been shown to possess neurotrophic activity, and is thought to be associated with neurologic disorders.

Product Specifications

Gene Name

IL3

Gene ID

3562

UniProt

P08700

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Pseudomonas entomophila 8-amino-7-oxononanoate synthase (bioF)
MBS1352479-01 0.02 mg (E-Coli)

Recombinant Pseudomonas entomophila 8-amino-7-oxononanoate synthase (bioF)

Ask
View Details
Recombinant Pseudomonas entomophila 8-amino-7-oxononanoate synthase (bioF)
MBS1352479-02 0.02 mg (Yeast)

Recombinant Pseudomonas entomophila 8-amino-7-oxononanoate synthase (bioF)

Ask
View Details
Recombinant Pseudomonas entomophila 8-amino-7-oxononanoate synthase (bioF)
MBS1352479-03 0.1 mg (E-Coli)

Recombinant Pseudomonas entomophila 8-amino-7-oxononanoate synthase (bioF)

Ask
View Details
Recombinant Pseudomonas entomophila 8-amino-7-oxononanoate synthase (bioF)
MBS1352479-04 0.1 mg (Yeast)

Recombinant Pseudomonas entomophila 8-amino-7-oxononanoate synthase (bioF)

Ask
View Details
Recombinant Pseudomonas entomophila 8-amino-7-oxononanoate synthase (bioF)
MBS1352479-05 0.02 mg (Baculovirus)

Recombinant Pseudomonas entomophila 8-amino-7-oxononanoate synthase (bioF)

Ask
View Details
Recombinant Pseudomonas entomophila 8-amino-7-oxononanoate synthase (bioF)
MBS1352479-06 0.02 mg (Mammalian-Cell)

Recombinant Pseudomonas entomophila 8-amino-7-oxononanoate synthase (bioF)

Ask
View Details