Recombinant Human PDCD4/H731 (C-6His)

Source: E. coli. MW :17kD. Recombinant Human Programmed Cell Death Protein 4 is produced by our E.coli expression system and the target gene encoding Lys212-Pro357 is expressed with a 6His tag at the C-terminus. Programmed Cell Death Protein 4 (PDCD4) is a member of the PDCD4 family. PDCD4 and EIF4A1 form a heterotrimer. One molecule of PDCD4 binds two molecules of EIF4A1. PDCD4 takes part in apoptosis via inhibiting translation initiation and cap-dependent translation.PDCD4 promotes colonic neoplastic transformation and tumor invasion. PDCD4 is an important target for microrna R-21 in breast cancer cells. Shortage of PDCD4 expression is associated with colorectal cancer. Overexpression of PDCD4 in carcinoid cells results in inhibition of cell proliferation.

Product Specifications

Gene Name

PDCD4

Gene ID

27250

UniProt

Q53EL6

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPLEHHHHHH