Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hematopoietic Prostaglandin D Synthase/HPGDS/GSTS

Source: E. coli. MW :23.6kD. Recombinant Human Hematopoietic Prostaglandin D Synthase is produced by our E.coli expression system and the target gene encoding Met1-Leu199 is expressed. Hematopoietic Prostaglandin D Synthase (HPGDS) belongs to the GST superfamily and Sigma family. HPGDS contains one GST C-terminal domain and one GST N-terminal domain. HPGDS is highly expressed in adipose tissue, macrophages, and placenta, and it exists in the form of homodimer in living body. HPGDS is a cytosolic enzyme that isomerizes PGH (2) . HPGDS is a bifunctional enzyme that catalyzes both the conversion of PGH2 to PGD2 and also shows low glutathione-peroxidase activity towards cumenehydroperoxide.

Product Specifications

Gene Name

HPGDS

Gene ID

27306

UniProt

O60760

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 200mM NaCl, pH 7.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HTLV1 (gp21 (351-404)) Human Protein
AR31020PU-N 100 µg

HTLV1 (gp21 (351-404)) Human Protein

Ask
View Details
Rabbit Polyclonal Wnt-10b Antibody [Alexa Fluor 488]
NBP1-77325AF488 0.1 mL

Rabbit Polyclonal Wnt-10b Antibody [Alexa Fluor 488]

Ask
View Details
FRRS1 (NM_001013660) Human Tagged ORF Clone Lentiviral Particle
RC219218L4V 200 µL

FRRS1 (NM_001013660) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Olr583 Rat shRNA Lentiviral Particle (Locus ID 405248)
TL700338V 500 µL Each

Olr583 Rat shRNA Lentiviral Particle (Locus ID 405248)

Ask
View Details