Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hematopoietic Prostaglandin D Synthase/HPGDS/GSTS

Source: E. coli. MW :23.6kD. Recombinant Human Hematopoietic Prostaglandin D Synthase is produced by our E.coli expression system and the target gene encoding Met1-Leu199 is expressed. Hematopoietic Prostaglandin D Synthase (HPGDS) belongs to the GST superfamily and Sigma family. HPGDS contains one GST C-terminal domain and one GST N-terminal domain. HPGDS is highly expressed in adipose tissue, macrophages, and placenta, and it exists in the form of homodimer in living body. HPGDS is a cytosolic enzyme that isomerizes PGH (2) . HPGDS is a bifunctional enzyme that catalyzes both the conversion of PGH2 to PGD2 and also shows low glutathione-peroxidase activity towards cumenehydroperoxide.

Product Specifications

Gene Name

HPGDS

Gene ID

27306

UniProt

O60760

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 200mM NaCl, pH 7.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BMP signaling agonist sb4
MBS3600057-01 5 mg

BMP signaling agonist sb4

Ask
View Details
BMP signaling agonist sb4
MBS3600057-02 10 mg

BMP signaling agonist sb4

Ask
View Details
BMP signaling agonist sb4
MBS3600057-03 25 mg

BMP signaling agonist sb4

Ask
View Details
BMP signaling agonist sb4
MBS3600057-04 50 mg

BMP signaling agonist sb4

Ask
View Details
BMP signaling agonist sb4
MBS3600057-05 100 mg

BMP signaling agonist sb4

Ask
View Details
BMP signaling agonist sb4
MBS3600057-06 200 mg

BMP signaling agonist sb4

Ask
View Details