Recombinant Human ETS1/EWSR2/P54 (N-6His)

Source: E. coli. MW :33kD. Recombinant Human ETS1 is produced by our E.coli expression system and the target gene encoding Met1-Thr272 is expressed with a 6His tag at the N-terminus. ETS1 Protein (ETS1) is a nuclear protein that belongs to the ETS family. Members of this family recognize the core consensus DNA sequence GGAA/T in target genes. Proteins function either as transcriptional activators or repressors of numerous genes. They are involved in stem cell development, cell senescence and death, and tumorigenesis. ETS1 is a transcription factor, containing one ETS DNA-binding domain and one PNT (pointed) domain. it has been shown to interact with TTRAP, UBE2I and Death Associated Protein 6.

Product Specifications

Gene Name

ETS1

Gene ID

2113

UniProt

Q96AC5

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM Nacl,1mM EDTA, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT