Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Autophagy Related 4 Homolog A/ATG4A (N-6His)

Source: E. coli. MW :47.5kD. Recombinant Human Autophagy protein 4A is produced by our E.coli expression system and the target gene encoding Met1-Val398 is expressed with a 6His tag at the N-terminus. Cysteine Protease ATG4A (ATG4A) is a cytoplasmic protein that belongs to the peptidase C54 family. ATG4A is widely expressed in many tissues at a low level, but the highest expression is observed in skeletal muscle and brain. ATG4A is a cysteine protease required for autophagy; it cleaves the C-terminal part of MAP1LC3, GABARAPL2 or GABARAP. ATG4A is inhibited by N-ethylmaleimide. It is suggested that ATG4A has a significant role in suppressing various cancers.

Product Specifications

Gene Name

ATG4A

Gene ID

115201

UniProt

Q8WYN0

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PRSS22 knockout cell line
ABC-KH12265 1 Vial

Human PRSS22 knockout cell line

Sign In for Pricing
View Details
WT1 Overexpression Lysate (Native) - (Dry Ice)
NBP2-11141 0.1 mg

WT1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
GPM6A, CT (GPM6A, M6A, Neuronal membrane glycoprotein M6-a) (MaxLight 405)
MBS6303606-01 0.1 mL

GPM6A, CT (GPM6A, M6A, Neuronal membrane glycoprotein M6-a) (MaxLight 405)

Sign In for Pricing
View Details
GPM6A, CT (GPM6A, M6A, Neuronal membrane glycoprotein M6-a) (MaxLight 405)
MBS6303606-02 5x 0.1 mL

GPM6A, CT (GPM6A, M6A, Neuronal membrane glycoprotein M6-a) (MaxLight 405)

Sign In for Pricing
View Details
CCNDBP1 Rabbit pAb
A13735 100 µL

CCNDBP1 Rabbit pAb

Sign In for Pricing
View Details
Human Fibronectin FN (FN) ELISA Kit
MBS3804492-01 48 Well

Human Fibronectin FN (FN) ELISA Kit

Sign In for Pricing
View Details