Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Aldehyde Dehydrogenase 1-A1/ALDH1A1 (N-6His)

Source: E. coli. MW :57kD. Recombinant Human Aldehyde Dehydrogenase 1-A1 is produced by our E.coli expression system and the target gene encoding Met1-Ser501 is expressed with a 6His tag at the N-terminus. Aldehyde Dehydrogenase Family 1 Member A1 (ALDH1A1) is a cytoplasmic enzyme that belongs to the Aldehyde Dehydrogenase family. ALDH1A1 is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties and subcellular localizations. ALDH1A1 is the main cytosolic isoform, which has a lower affinity for aldehydes than the mitochondrial enzyme. ALDH1A1 binds free retinal and cellular retinol-binding protein-bound retinal. It can convert/oxidize retinaldehyde to retinoic acid.

Product Specifications

Gene Name

ALDH1A1

Gene ID

216

UniProt

P00352

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, pH8.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Campylobacter jejuni Elongation factor Tu (tuf)
MBS1420153-01 0.02 mg (E-Coli)

Recombinant Campylobacter jejuni Elongation factor Tu (tuf)

Ask
View Details
Recombinant Campylobacter jejuni Elongation factor Tu (tuf)
MBS1420153-02 0.02 mg (Yeast)

Recombinant Campylobacter jejuni Elongation factor Tu (tuf)

Ask
View Details
Recombinant Campylobacter jejuni Elongation factor Tu (tuf)
MBS1420153-03 0.1 mg (E-Coli)

Recombinant Campylobacter jejuni Elongation factor Tu (tuf)

Ask
View Details
Recombinant Campylobacter jejuni Elongation factor Tu (tuf)
MBS1420153-04 0.1 mg (Yeast)

Recombinant Campylobacter jejuni Elongation factor Tu (tuf)

Ask
View Details
Recombinant Campylobacter jejuni Elongation factor Tu (tuf)
MBS1420153-05 0.02 mg (Baculovirus)

Recombinant Campylobacter jejuni Elongation factor Tu (tuf)

Ask
View Details
Recombinant Campylobacter jejuni Elongation factor Tu (tuf)
MBS1420153-06 0.02 mg (Mammalian-Cell)

Recombinant Campylobacter jejuni Elongation factor Tu (tuf)

Ask
View Details