Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Acyl-Protein Thioesterase 2/LYPLA2/APT2 (C-6His)

Source: E. coli. MW :25.8kD. Recombinant Human Lysophospholipase II is produced by our E.coli expression system and the target gene encoding Met1-Val231 is expressed with a 6His tag at the C-terminus. Acyl-Protein Thioesterase 2 is a cytoplasmic protein that belongs to the AB Hydrolase 2 family. LYPLA2 is a lysophospholipase and hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. LYPLA2 has hydrolase activity that converts Palmitoyl-protein to palmitate and protein. LYPLA2 regulates the multifunctional lysophospholipids by acting on biological membranes. LYPLA2 participates in Glycerophospholipid metabolism pathway, fatty acid metabolic process and lipid metabolic process.

Product Specifications

Gene Name

LYPLA2

Gene ID

11313

UniProt

O95372

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 1mM DTT, 0.1M NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPVLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human GPR155 qPCR Primer Pair
QH65441S 200 Tests

Human GPR155 qPCR Primer Pair

Ask
View Details
Human Protein KIAA0649, KIAA0649 ELISA Kit
MBS9327372-01 48 Well

Human Protein KIAA0649, KIAA0649 ELISA Kit

Ask
View Details
Human Protein KIAA0649, KIAA0649 ELISA Kit
MBS9327372-02 96 Well

Human Protein KIAA0649, KIAA0649 ELISA Kit

Ask
View Details
Human Protein KIAA0649, KIAA0649 ELISA Kit
MBS9327372-03 5x 96 Well

Human Protein KIAA0649, KIAA0649 ELISA Kit

Ask
View Details
Human Protein KIAA0649, KIAA0649 ELISA Kit
MBS9327372-04 10x 96 Well

Human Protein KIAA0649, KIAA0649 ELISA Kit

Ask
View Details
NALP2 (H-4) Alexa Fluor® 546
sc-166584 AF546 200 µg/mL

NALP2 (H-4) Alexa Fluor® 546

Ask
View Details