Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ribulose-Phosphate 3-Epimerase/RPE (C-6His)

Source: E. coli. MW :25.9kD. Recombinant Human Ribulose-Phosphate 3-Epimerase is produced by our E.coli expression system and the target gene encoding Met1-Arg228 is expressed with a 6His tag at the C-terminus. Ribulose-Phosphate 3-Epimerase (RPE) is a member of the Ribulose-Phosphate 3-Epimerase family. RPE exists as a homodimer and catalyzes the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate. RPE binds one divalent metal cation per subunit and contains tightly bound Fe2+ when produced in E. coli, but the physiological cofactor may be Co2+, Mn2+ or Zn2+. It has been shown that RPE participates in 3 metabolic pathways: pentose phosphate pathway, pentose and glucuronate interconversions, and carbon fixation.

Product Specifications

Gene Name

RPE

Gene ID

6120

UniProt

Q96AT9

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 6.2.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDRVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NFkB (Nuclear Factor Kappa B) Mouse ELISA Kit
F3859 96 Tests

NFkB (Nuclear Factor Kappa B) Mouse ELISA Kit

Ask
View Details
Human Deoxyguanosine Kinase (DGUOK) ELISA Kit
MBS9311245-01 48 Well

Human Deoxyguanosine Kinase (DGUOK) ELISA Kit

Ask
View Details
Human Deoxyguanosine Kinase (DGUOK) ELISA Kit
MBS9311245-02 96 Well

Human Deoxyguanosine Kinase (DGUOK) ELISA Kit

Ask
View Details
Human Deoxyguanosine Kinase (DGUOK) ELISA Kit
MBS9311245-03 5x 96 Well

Human Deoxyguanosine Kinase (DGUOK) ELISA Kit

Ask
View Details
Human Deoxyguanosine Kinase (DGUOK) ELISA Kit
MBS9311245-04 10x 96 Well

Human Deoxyguanosine Kinase (DGUOK) ELISA Kit

Ask
View Details
Solute Carrier Family 5 (Neutral Amino Acid Transporters, System A), Member 4 (SLC5A4, DJ90G24.4, NA, SAAT1) discontinued
S5328-94K 50 µg

Solute Carrier Family 5 (Neutral Amino Acid Transporters, System A), Member 4 (SLC5A4, DJ90G24.4, NA, SAAT1) discontinued

Ask
View Details