Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ribulose-Phosphate 3-Epimerase/RPE (C-6His)

Source: E. coli. MW :25.9kD. Recombinant Human Ribulose-Phosphate 3-Epimerase is produced by our E.coli expression system and the target gene encoding Met1-Arg228 is expressed with a 6His tag at the C-terminus. Ribulose-Phosphate 3-Epimerase (RPE) is a member of the Ribulose-Phosphate 3-Epimerase family. RPE exists as a homodimer and catalyzes the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate. RPE binds one divalent metal cation per subunit and contains tightly bound Fe2+ when produced in E. coli, but the physiological cofactor may be Co2+, Mn2+ or Zn2+. It has been shown that RPE participates in 3 metabolic pathways: pentose phosphate pathway, pentose and glucuronate interconversions, and carbon fixation.

Product Specifications

Gene Name

RPE

Gene ID

6120

UniProt

Q96AT9

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 6.2.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDRVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Hsa-miR-181c-5p miRNA Agomir
CMJ0063-01 5 nmol

Hsa-miR-181c-5p miRNA Agomir

Ask
View Details
Hsa-miR-181c-5p miRNA Agomir
CMJ0063-02 10 nmol

Hsa-miR-181c-5p miRNA Agomir

Ask
View Details
Hsa-miR-181c-5p miRNA Agomir
CMJ0063-03 20 nmol

Hsa-miR-181c-5p miRNA Agomir

Ask
View Details
Zswim1 (BC025184) Mouse Tagged ORF Clone
MR205472 10 µg

Zswim1 (BC025184) Mouse Tagged ORF Clone

Ask
View Details
Bis-NH2-C1-PEG3
C08044 100 mg

Bis-NH2-C1-PEG3

Ask
View Details
Eppendorf Safe-Lock micro test tubes 1.5ml green
E0030120183 1000 / PCK

Eppendorf Safe-Lock micro test tubes 1.5ml green

Ask
View Details