Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SH2 Domain-Containing Protein 1A/SH2D1A/SAP/DSHP (N-6His)

Source: E. coli. MW :16.3kD. Recombinant Human SH2D1A is produced by our E.coli expression system and the target gene encoding Met1-Pro128 is expressed with a 6His tag at the N-terminus. SH2 Domain-Containing Protein 1A, (SH2D1A) contains one SH2 domain and a short tail and is localized in the cytoplasm. SH2D1A is expressed at a high level in the thymus and the lung, with lower expression levels in the spleen and the liver. SH2D1A acts as an inhibitor of the signaling lymphocyte activation molecule (SLAM) self-association. In addition, SH2D1A mediates interaction between FYN and SLAMF1. It is also thought to regulate the activity of the neurotrophin receptors NTRK1, NTRK2 and NTRK3.

Product Specifications

Gene Name

SH2D1A

Gene ID

4068

UniProt

O60880

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, 10% Glycerol, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Guinea pig permeability glycoprotein (P-gp) ELISA Kit
EIA07803Gu 1 Kit

Guinea pig permeability glycoprotein (P-gp) ELISA Kit

Ask
View Details
Recombinant Rhodopseudomonas palustris 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (fabA)
MBS1379152-01 0.02 mg (E-Coli)

Recombinant Rhodopseudomonas palustris 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (fabA)

Ask
View Details
Recombinant Rhodopseudomonas palustris 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (fabA)
MBS1379152-02 0.1 mg (E-Coli)

Recombinant Rhodopseudomonas palustris 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (fabA)

Ask
View Details
Recombinant Rhodopseudomonas palustris 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (fabA)
MBS1379152-03 0.02 mg (Yeast)

Recombinant Rhodopseudomonas palustris 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (fabA)

Ask
View Details
Recombinant Rhodopseudomonas palustris 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (fabA)
MBS1379152-04 0.1 mg (Yeast)

Recombinant Rhodopseudomonas palustris 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (fabA)

Ask
View Details
Recombinant Rhodopseudomonas palustris 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (fabA)
MBS1379152-05 0.02 mg (Baculovirus)

Recombinant Rhodopseudomonas palustris 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (fabA)

Ask
View Details