Recombinant Human SH2 Domain-Containing Protein 1A/SH2D1A/SAP/DSHP (N-6His)
Source: E. coli. MW :16.3kD. Recombinant Human SH2D1A is produced by our E.coli expression system and the target gene encoding Met1-Pro128 is expressed with a 6His tag at the N-terminus. SH2 Domain-Containing Protein 1A, (SH2D1A) contains one SH2 domain and a short tail and is localized in the cytoplasm. SH2D1A is expressed at a high level in the thymus and the lung, with lower expression levels in the spleen and the liver. SH2D1A acts as an inhibitor of the signaling lymphocyte activation molecule (SLAM) self-association. In addition, SH2D1A mediates interaction between FYN and SLAMF1. It is also thought to regulate the activity of the neurotrophin receptors NTRK1, NTRK2 and NTRK3.
Product Specifications
Gene Name
SH2D1A
Gene ID
4068
UniProt
O60880
Components
Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, 10% Glycerol, pH 7.5.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MGSSHHHHHHSSGLVPRGSHMDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items