Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human dUTP Pyrophosphatase/dUTPase

Source: E.coli. MW :20kD. Recombinant Human Deoxyuridine 5'-Triphosphate Nucleotidohydrolase, Mitochondrial is produced by our E.coli expression system and the target gene encoding Met1-Asn164 is expressed with a 6His tag at the N-terminus. Deoxyuridine 5'-Triphosphate Nucleotidohydrolase Mitochondrial (dUTPase) belongs to the dUTPase family. dUTPase exits as a homotrimer and is involved in nucleotide metabolism. dUTPase produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA. The dUTPase increase in PCR product yield, length and fidelity enables further down-stream applications. These effects make dUTPase useful in PCR fidelity and yield-sensitive applications. dUTPase is specific for dUTP and is critical for the fidelity of DNA replication and repair.

Product Specifications

Gene Name

DUT

Gene ID

1854

UniProt

P33316

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Tnfsf13 (NM_001159505) AAV Particle
MR202987A1V 250 µL

Mouse Tnfsf13 (NM_001159505) AAV Particle

Ask
View Details
RPA32 Antibody / Replication Protein A2
V7392-20UG 20 µg

RPA32 Antibody / Replication Protein A2

Ask
View Details
Recombinant Human STK25 Protein - (Dry Ice)
H00010494-P01-2ug 2 µg

Recombinant Human STK25 Protein - (Dry Ice)

Ask
View Details
Hepatitis B Surface Ag (HBsAg)
GWB-FD9B8A 1 mg

Hepatitis B Surface Ag (HBsAg)

Ask
View Details
Human C-C motif chemokine 26 (CCL26) ELISA Kit
YLA0587HU-01 48 Tests

Human C-C motif chemokine 26 (CCL26) ELISA Kit

Ask
View Details
Human C-C motif chemokine 26 (CCL26) ELISA Kit
YLA0587HU-02 96 Tests

Human C-C motif chemokine 26 (CCL26) ELISA Kit

Ask
View Details