Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-Conjugating Enzyme E2 I/UBE2I (N-GST)

Source: E. coli. MW :44.4kD. Recombinant Human Ubiquitin-Conjugating Enzyme E2 I is produced by our E.coli expression system and the target gene encoding Met1-Ser158 is expressed with a GST tag at the N-terminus. SUMO-Conjugating Enzyme UBC9 (UBC9) belongs to the ubiquitin-conjugating enzyme family. UBC9 is homologous to ubiquitin-conjugating enzymes (E2s) . However, instead of conjugating ubiquitin, UBC9 conjugates a ubiquitin homologue, Small Ubiquitin-Like Modifier 1 (SUMO-1) . The conjugation of ubiquitin requires the activities of ubiquitin-activating (E1) and conjugating (E2) enzymes. It is suggested that UBC9 might play a role in DNA repair and perhaps even in aging.

Product Specifications

Gene Name

UBE2I

Gene ID

7329

UniProt

P63279

Components

Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS
More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm12888 Protein Vector (Mouse) (pPB-C-His)
PV182858 500 ng

Gm12888 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Putative nascent Polypeptide-associated complex subunit α-Like protein (NACAP1) Human ELISA Kit
G5413 96 Tests

Putative nascent Polypeptide-associated complex subunit α-Like protein (NACAP1) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Nanog
N140-1 mg 1 mg

Recombinant Human Nanog

Sign In for Pricing
View Details
DI-POTASSIUM PHTHALATE
JH301243 1 Each

DI-POTASSIUM PHTHALATE

Sign In for Pricing
View Details
CSNK2A1
ant-372 5µg

CSNK2A1

Sign In for Pricing
View Details
Reg4 ORF Vector (Rat) (pORF)
38800016 1.0 µg DNA

Reg4 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details