Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-Conjugating Enzyme E2 I/UBE2I (N-GST)

Source: E. coli. MW :44.4kD. Recombinant Human Ubiquitin-Conjugating Enzyme E2 I is produced by our E.coli expression system and the target gene encoding Met1-Ser158 is expressed with a GST tag at the N-terminus. SUMO-Conjugating Enzyme UBC9 (UBC9) belongs to the ubiquitin-conjugating enzyme family. UBC9 is homologous to ubiquitin-conjugating enzymes (E2s) . However, instead of conjugating ubiquitin, UBC9 conjugates a ubiquitin homologue, Small Ubiquitin-Like Modifier 1 (SUMO-1) . The conjugation of ubiquitin requires the activities of ubiquitin-activating (E1) and conjugating (E2) enzymes. It is suggested that UBC9 might play a role in DNA repair and perhaps even in aging.

Product Specifications

Gene Name

UBE2I

Gene ID

7329

UniProt

P63279

Components

Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RNU7-80P 3'UTR Lenti-reporter-Luc Vector
40595081 1.0 µg

RNU7-80P 3'UTR Lenti-reporter-Luc Vector

Ask
View Details
3-[4- (propan-2-yloxy) phenyl]propan-1-amine
sc-345976A 1 g

3-[4- (propan-2-yloxy) phenyl]propan-1-amine

Ask
View Details
ABCG8 Antibody, HRP conjugated
A68785-100UG 100 µg

ABCG8 Antibody, HRP conjugated

Ask
View Details
Lentiviral mouse Cnr1 shRNA (UAS) - Lentiviral mouse Cnr1 shRNA (UAS, iRFP) plasmid
GTR15174964 1 Vial

Lentiviral mouse Cnr1 shRNA (UAS) - Lentiviral mouse Cnr1 shRNA (UAS, iRFP) plasmid

Ask
View Details
L-161240
HY-124334 1 mg

L-161240

Ask
View Details