Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-Conjugating Enzyme E2 I/UBE2I (N-GST)

Source: E. coli. MW :44.4kD. Recombinant Human Ubiquitin-Conjugating Enzyme E2 I is produced by our E.coli expression system and the target gene encoding Met1-Ser158 is expressed with a GST tag at the N-terminus. SUMO-Conjugating Enzyme UBC9 (UBC9) belongs to the ubiquitin-conjugating enzyme family. UBC9 is homologous to ubiquitin-conjugating enzymes (E2s) . However, instead of conjugating ubiquitin, UBC9 conjugates a ubiquitin homologue, Small Ubiquitin-Like Modifier 1 (SUMO-1) . The conjugation of ubiquitin requires the activities of ubiquitin-activating (E1) and conjugating (E2) enzymes. It is suggested that UBC9 might play a role in DNA repair and perhaps even in aging.

Product Specifications

Gene Name

UBE2I

Gene ID

7329

UniProt

P63279

Components

Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

β-Nicotinamide adenine dinucleotide (NADH) (reduced state)
HH3201-02 10 g

β-Nicotinamide adenine dinucleotide (NADH) (reduced state)

Ask
View Details
Glycoprotein hormone beta 5 (Thyrostimulin Beta Subunit, GPHB5, TSH)
G8179-26A 100 µg

Glycoprotein hormone beta 5 (Thyrostimulin Beta Subunit, GPHB5, TSH)

Ask
View Details
Lentiviral mouse Hrc shRNA (UAS) - Lentiviral mouse Hrc shRNA (UAS, GFP) (100)
GTR15275493 1 Vial

Lentiviral mouse Hrc shRNA (UAS) - Lentiviral mouse Hrc shRNA (UAS, GFP) (100)

Ask
View Details
Anti-Pin1 Antibody FITC
STJ502500 100 µg

Anti-Pin1 Antibody FITC

Ask
View Details
Human CORO7-PAM16 knockdown cell line
ABC-KD3455 1 Vial

Human CORO7-PAM16 knockdown cell line

Ask
View Details
ZNF595 (NM_182524) Human Tagged ORF Clone Lentiviral Particle
RC206348L3V 200 µL

ZNF595 (NM_182524) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details