Recombinant Human Mitochondrial Fission 1 Protein/FIS1 (C-6His)
Source: E. coli. MW :15.2kD. Recombinant Human Mitochondrial Fission 1 Protein is produced by our E.coli expression system and the target gene encoding Met1-Gly122 is expressed with a 6His tag at the C-terminus. Mitochondrial Fission 1 Protein (FIS1) is a member of the FIS1 family. FIS1 is a single-pass membrane protein and contains one TPR repeat. FIS1 is part of the mitochondrial complex that promotes mitochondrial fission. FIS1 can induce cytochrome C discharge from the mitochondrion to the cytosol, eventually leading to apoptosis. In addition, FIS1 participates in peroxisomal growth and division. The C-terminus of FIS1 is required for mitochondrial or peroxisomal localization, while the N-terminus is necessary for mitochondrial or peroxisomal fission, localization and regulation of the interaction with DNM1L.
Product Specifications
Gene Name
FIS1
Gene ID
51024
UniProt
Q9Y3D6
Components
Lyophilized from a 0.2 μm filtered solution of 20mM Tris, pH 8.0.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGVEHHHHHH
Explore Other Products
Browse additional items from our catalog