Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carbonic Anhydrase 3/CA3 (C-6His)

Source: E. coli. MW :30.6kD. Recombinant Human Carbonic Anhydrase 3 is produced by our E.coli expression system and the target gene encoding Ala2-Lys260 is expressed with a 6His tag at the C-terminus. Carbonic Anhydrase 3 (CA3) belongs to the Alpha-Carbonic Anhydrase family that encodes carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and it is present at high levels in skeletal muscle with much lower levels found in cardiac and smooth muscle. CA3 is activated by proton donors such as imidazole and the dipeptide histidylhistidine. CA3 is inhibited by coumarins and sulfonamide derivatives such as acetazolamide.

Product Specifications

Gene Name

CA3

Gene ID

761

UniProt

P07451

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFKLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FOXQ1 (Forkhead Box Protein Q1, HNF-3/Forkhead-like Protein 1, HFH-1, Hepatocyte Nuclear Factor 3 Forkhead Homolog 1, HFH1) (Biotin)
MBS6141963-01 0.1 mL

FOXQ1 (Forkhead Box Protein Q1, HNF-3/Forkhead-like Protein 1, HFH-1, Hepatocyte Nuclear Factor 3 Forkhead Homolog 1, HFH1) (Biotin)

Ask
View Details
FOXQ1 (Forkhead Box Protein Q1, HNF-3/Forkhead-like Protein 1, HFH-1, Hepatocyte Nuclear Factor 3 Forkhead Homolog 1, HFH1) (Biotin)
MBS6141963-02 5x 0.1 mL

FOXQ1 (Forkhead Box Protein Q1, HNF-3/Forkhead-like Protein 1, HFH-1, Hepatocyte Nuclear Factor 3 Forkhead Homolog 1, HFH1) (Biotin)

Ask
View Details
JIP3 Antibody
MBS9509632-01 0.05 mL

JIP3 Antibody

Ask
View Details
JIP3 Antibody
MBS9509632-02 0.1 mL

JIP3 Antibody

Ask
View Details
JIP3 Antibody
MBS9509632-03 5x 0.1 mL

JIP3 Antibody

Ask
View Details
Rabbit Polyclonal TCEAL3 Antibody [FITC]
NBP2-98537F 0.1 mL

Rabbit Polyclonal TCEAL3 Antibody [FITC]

Ask
View Details