Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PDCD10/TFAR15

Source: E. coli. MW :24.9kD. Recombinant Human Programmed Cell Death Protein 10 is produced by our E.coli expression system and the target gene encoding Met1-Ala212 is expressed. Programmed Cell Death Protein 10 (PDCD10) belongs to the PDCD10 family. PDCD10 exists as a homodimer and is widely expressed. PDCD10 can increase mitogen-activated protein kinase activity and MST4 activity. PDCD10 is required for normal cardiovascular development and normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development. Defects in PDCD10 are the cause of cerebral cavernous malformations type 3.

Product Specifications

Gene Name

PDCD10

Gene ID

11235

UniProt

Q9BUL8

Components

Lyophilized from a 0.2 μm filtered solution of 25mM TrisHCl, pH7.3.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GSHMRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (3,5-di-tert-butylphenyl) -2,2-dimethylpropan-1-ol
OR1091242-01 250 mg

1- (3,5-di-tert-butylphenyl) -2,2-dimethylpropan-1-ol

Sign In for Pricing
View Details
1- (3,5-di-tert-butylphenyl) -2,2-dimethylpropan-1-ol
OR1091242-02 500 mg

1- (3,5-di-tert-butylphenyl) -2,2-dimethylpropan-1-ol

Sign In for Pricing
View Details
1- (3,5-di-tert-butylphenyl) -2,2-dimethylpropan-1-ol
OR1091242-03 1 g

1- (3,5-di-tert-butylphenyl) -2,2-dimethylpropan-1-ol

Sign In for Pricing
View Details
Recombinant Human ZW10 Interactor/ZWINT (N-6His)
C267-50ug 50 µg

Recombinant Human ZW10 Interactor/ZWINT (N-6His)

Sign In for Pricing
View Details
SLC13A1 Adenovirus (Mouse)
43879054 1.0 mL

SLC13A1 Adenovirus (Mouse)

Sign In for Pricing
View Details
Mouse Anti-Human CD25 mAb (PerCP/Cy5.5)
orb2710303 100 Tests

Mouse Anti-Human CD25 mAb (PerCP/Cy5.5)

Sign In for Pricing
View Details