Recombinant Human PDCD10/TFAR15

Source: E. coli. MW :24.9kD. Recombinant Human Programmed Cell Death Protein 10 is produced by our E.coli expression system and the target gene encoding Met1-Ala212 is expressed. Programmed Cell Death Protein 10 (PDCD10) belongs to the PDCD10 family. PDCD10 exists as a homodimer and is widely expressed. PDCD10 can increase mitogen-activated protein kinase activity and MST4 activity. PDCD10 is required for normal cardiovascular development and normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development. Defects in PDCD10 are the cause of cerebral cavernous malformations type 3.

Product Specifications

Gene Name

PDCD10

Gene ID

11235

UniProt

Q9BUL8

Components

Lyophilized from a 0.2 μm filtered solution of 25mM TrisHCl, pH7.3.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GSHMRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA