Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T Cell Receptor Interacting Molecule/TRIM/TCRIM/TRAT1 (C-6His)

Source: E. coli. MW :19.4kD. Recombinant Human TRIM is produced by our E.coli expression system and the target gene encoding Asn29-Asn186 is expressed with a 6His tag at the C-terminus. T-Cell Receptor-Associated Transmembrane Adapter 1 (TRAT1) is a single-pass type III membrane protein. TRAT1 exists as a disulfide-linked homodimer and is strongly expressed in the thymus, and to a lesser extent in the spleen, lymph node, and peripheral blood lymphocytes. TRAT1 is phosphorylated on tyrosines by LCK or FYN upon TCR activation. Its function is to stabilizes the TCR (T-cell antigen receptor) /CD3 complex at the surface of T-cells.

Product Specifications

Gene Name

TRAT1

Gene ID

50852

UniProt

Q6PIZ9

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,10% Glycerol, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPINLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Obestatin (OB) ELISA Kit
AE30020HU-01 48 Tests

Human Obestatin (OB) ELISA Kit

Ask
View Details
Human Obestatin (OB) ELISA Kit
AE30020HU-02 96 Tests

Human Obestatin (OB) ELISA Kit

Ask
View Details
Fmoc-glycine 4-alkoxybenzyl alcohol resin
276897-01 10 g

Fmoc-glycine 4-alkoxybenzyl alcohol resin

Ask
View Details
Fmoc-glycine 4-alkoxybenzyl alcohol resin
276897-02 25 g

Fmoc-glycine 4-alkoxybenzyl alcohol resin

Ask
View Details
Fmoc-glycine 4-alkoxybenzyl alcohol resin
276897-03 50 g

Fmoc-glycine 4-alkoxybenzyl alcohol resin

Ask
View Details
Fmoc-glycine 4-alkoxybenzyl alcohol resin
276897-04 100 g

Fmoc-glycine 4-alkoxybenzyl alcohol resin

Ask
View Details