Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serum Amyloid A4/SAA4 (C-6His)

Source: E. coli. MW :14kD. Recombinant Human Serum Amyloid A4 Protein is produced by our E.coli expression system and the target gene encoding Glu19-Thr130 is expressed with a 6His tag at the C-terminus. Serum Amyloid A-4 Protein (SAA4) is a member of the SAA family. SAA proteins are a family of apolipoproteins associated with high-density lipoprotein (HDL) in plasma. SAA4 is constitutively expressed only in humans and mice. Its physiological function is unknown. SAA4 functions as a major acute phase reactant. SAA4 mRNA and protein occurrence in macrophage derived foam cells of coronary and carotid arteries implied a specific role of human SAA4 during inflammation including atherosclerosis.

Product Specifications

Gene Name

SAA4

Gene ID

6291

UniProt

P35542

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 200mM NaCl, 0.5mM EDTA, 20% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKYLEHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal TLE1 Antibody [Alexa Fluor 594]
NBP2-04105AF594 0.1 mL

Rabbit Polyclonal TLE1 Antibody [Alexa Fluor 594]

Ask
View Details
Papolg Mouse shRNA Lentiviral Particle (Locus ID 216578)
TL506493V 500 µL Each

Papolg Mouse shRNA Lentiviral Particle (Locus ID 216578)

Ask
View Details
CDKN2B Antibody; HRP conjugated
MBS7001460-01 0.05 mg

CDKN2B Antibody; HRP conjugated

Ask
View Details
CDKN2B Antibody; HRP conjugated
MBS7001460-02 0.1 mg

CDKN2B Antibody; HRP conjugated

Ask
View Details
CDKN2B Antibody; HRP conjugated
MBS7001460-03 5x 0.1 mg

CDKN2B Antibody; HRP conjugated

Ask
View Details
Rat Immunoglobulin A (IgA) ELISA Kit
MBS287009-01 48 Tests

Rat Immunoglobulin A (IgA) ELISA Kit

Ask
View Details