Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serum Amyloid A4/SAA4 (C-6His)

Source: E. coli. MW :14kD. Recombinant Human Serum Amyloid A4 Protein is produced by our E.coli expression system and the target gene encoding Glu19-Thr130 is expressed with a 6His tag at the C-terminus. Serum Amyloid A-4 Protein (SAA4) is a member of the SAA family. SAA proteins are a family of apolipoproteins associated with high-density lipoprotein (HDL) in plasma. SAA4 is constitutively expressed only in humans and mice. Its physiological function is unknown. SAA4 functions as a major acute phase reactant. SAA4 mRNA and protein occurrence in macrophage derived foam cells of coronary and carotid arteries implied a specific role of human SAA4 during inflammation including atherosclerosis.

Product Specifications

Gene Name

SAA4

Gene ID

6291

UniProt

P35542

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 200mM NaCl, 0.5mM EDTA, 20% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKYLEHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal ACP6 Antibody [Alexa Fluor 532]
NBP2-99166AF532 0.1 mL

Rabbit Polyclonal ACP6 Antibody [Alexa Fluor 532]

Ask
View Details
CD48 (NM_001778) Human Tagged ORF Clone Lentiviral Particle
RC204849L1V 200 µL

CD48 (NM_001778) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
PI 3-kinase p85 Alpha Polyclonal Antibody
JOT-AP07143-01 50ul

PI 3-kinase p85 Alpha Polyclonal Antibody

Ask
View Details
PI 3-kinase p85 Alpha Polyclonal Antibody
JOT-AP07143-02 100ul

PI 3-kinase p85 Alpha Polyclonal Antibody

Ask
View Details
Human CDC26 Knockout A549 cell line
GTR15408192 1 Vial

Human CDC26 Knockout A549 cell line

Ask
View Details
Rfxank Mouse shRNA Lentiviral Particle (Locus ID 19727)
TL515424V 500 µL Each

Rfxank Mouse shRNA Lentiviral Particle (Locus ID 19727)

Ask
View Details