Recombinant Human C-X-C Motif Chemokine 5/CXCL5
Source: E. coli. MW :7.95kD. Recombinant Human C-X-C Motif Chemokine 5 is produced by our E.coli expression system and the target gene encoding Leu44-Asn114 is expressed. C-X-C Motif Chemokine 5 (CXCL5) is a member of the Intercrine Alpha (Chemokine CXC) family. CXCL5 can be cleaved into the following two chains, ENA-78 (8-78) and ENA-78 (9-78) . In vitro, ENA-78 (8-78) and ENA-78 (9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. CXCL5 is a secreted protein and exercises the functions primarily through interactions with CXCR2. The upregulation of CXCL5 contributes to increased vascularization, tumor grown, and metastasis in many cancers.
Product Specifications
Gene Name
CXCL5
Gene ID
6374
UniProt
P42830
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, pH 6.0.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
MLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items