Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C Motif Chemokine 5/CXCL5

Source: E. coli. MW :7.95kD. Recombinant Human C-X-C Motif Chemokine 5 is produced by our E.coli expression system and the target gene encoding Leu44-Asn114 is expressed. C-X-C Motif Chemokine 5 (CXCL5) is a member of the Intercrine Alpha (Chemokine CXC) family. CXCL5 can be cleaved into the following two chains, ENA-78 (8-78) and ENA-78 (9-78) . In vitro, ENA-78 (8-78) and ENA-78 (9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. CXCL5 is a secreted protein and exercises the functions primarily through interactions with CXCR2. The upregulation of CXCL5 contributes to increased vascularization, tumor grown, and metastasis in many cancers.

Product Specifications

Gene Name

CXCL5

Gene ID

6374

UniProt

P42830

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, pH 6.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DNAJC16 Antibody - N-terminal region
MBS3208440-01 0.1 mL

DNAJC16 Antibody - N-terminal region

Ask
View Details
DNAJC16 Antibody - N-terminal region
MBS3208440-02 5x 0.1 mL

DNAJC16 Antibody - N-terminal region

Ask
View Details
Bre (Babam2) (NM_181282) Mouse Tagged Lenti ORF Clone
MR205985L4 10 µg

Bre (Babam2) (NM_181282) Mouse Tagged Lenti ORF Clone

Ask
View Details
CCNB1 Antibody
MBS850871-01 0.1 mg

CCNB1 Antibody

Ask
View Details
CCNB1 Antibody
MBS850871-02 0.1 mL (AF405L)

CCNB1 Antibody

Ask
View Details
CCNB1 Antibody
MBS850871-03 0.1 mL (AF405S)

CCNB1 Antibody

Ask
View Details