Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B-Cell Differentiation Antigen CD72/Lyb-2 (N-Trx, 6His)

Source: E. coli. MW :30.6kD. Recombinant Human CD72 is produced by our E.coli expression system and the target gene encoding Arg117-Cys226 is expressed with a Trx, 6His tag at the N-terminus. B-Cell Differentiation Antigen CD72 (CD72) is a single-pass type II membrane protein. CD72 exists as a disulfide-linked homodimer and contains one C-type lectin domain. CD72 is expressed on B lineage cells, NK cells, monocytes, dendritic cells, and mast cells. CD72 is a ligand for CD5. CD72 associates with CD5, interacts with PTPN6/SHP-1 and plays a role in B-cell proliferation and differentiation. CD72 associates with CD79A in the B cell antigen receptor (BCR) complex following antigen stimulation and dampens BCR signaling through interactions with the phosphatase SHP-1.

Product Specifications

Gene Name

CD72

Gene ID

971

UniProt

P21854

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSMRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTC
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Horse Putative Phospholipase B-Like 2 (PLBD2) ELISA Kit
MBS9362132-01 48 Well

Horse Putative Phospholipase B-Like 2 (PLBD2) ELISA Kit

Ask
View Details
Horse Putative Phospholipase B-Like 2 (PLBD2) ELISA Kit
MBS9362132-02 96 Well

Horse Putative Phospholipase B-Like 2 (PLBD2) ELISA Kit

Ask
View Details
Horse Putative Phospholipase B-Like 2 (PLBD2) ELISA Kit
MBS9362132-03 5x 96 Well

Horse Putative Phospholipase B-Like 2 (PLBD2) ELISA Kit

Ask
View Details
Horse Putative Phospholipase B-Like 2 (PLBD2) ELISA Kit
MBS9362132-04 10x 96 Well

Horse Putative Phospholipase B-Like 2 (PLBD2) ELISA Kit

Ask
View Details
NSUN4 (NM_199044) Human Tagged ORF Clone Lentiviral Particle
RC204836L1V 200 µL

NSUN4 (NM_199044) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Eleutheroside B
SM1075-100mg 100 mg

Eleutheroside B

Ask
View Details