Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-X-C Motif Chemokine 2/CXCL2/MIP-2

Source: E.coli. MW :7.9kD. Recombinant Mouse C-X-C motif chemokine 2 is produced by our E.coli expression system and the target gene encoding Ala28-Asn100 is expressed. C-X-C motif chemokine 2 (CXCL2, MIP-2) belongs to the intercrine alpha (chemokine CxC) family. It was originally identified as a heparin-binding protein secreted from a murine macrophage cell line in response to endotoxin stimulation. The expression of mouse MIP-2 is stimulated by endotoxin. The mouse MIP-2 shares approximately 63% aa sequence identity with murine KC, another mouse alpha chemokine, which is induced by PDGF. It has been suggested that mouse KC and MIP-2 are the homologs of the human GROs and rat CINCs. Chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst. The expression of MIP-2 was found to be associated with neutrophil influx in pulmonary inflammation and glomerulonephritis, suggesting that MIP-2 may contribute to the pathogenesis of inflammatory diseases.

Product Specifications

Gene Name

Cxcl2

Gene ID

20310

UniProt

P10889

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tmem167 (BC024352) Mouse Untagged Clone
MC206892 10 µg

Tmem167 (BC024352) Mouse Untagged Clone

Ask
View Details
anti-MEK7
YF-PA24477 50 ul

anti-MEK7

Ask
View Details
IgD (Immunoglobulin D Heavy Constant Delta) discontinued
376443 500 µg

IgD (Immunoglobulin D Heavy Constant Delta) discontinued

Ask
View Details
Atrial Natriuretic Peptide (ANP, Atrial Natriuretic Factor)
MBS6507020-01 0.1 mg

Atrial Natriuretic Peptide (ANP, Atrial Natriuretic Factor)

Ask
View Details
Atrial Natriuretic Peptide (ANP, Atrial Natriuretic Factor)
MBS6507020-02 0.5 mg

Atrial Natriuretic Peptide (ANP, Atrial Natriuretic Factor)

Ask
View Details
Atrial Natriuretic Peptide (ANP, Atrial Natriuretic Factor)
MBS6507020-03 1 mg

Atrial Natriuretic Peptide (ANP, Atrial Natriuretic Factor)

Ask
View Details