Recombinant Mouse C-X-C Motif Chemokine 2/CXCL2/MIP-2
Source: E.coli. MW :7.9kD. Recombinant Mouse C-X-C motif chemokine 2 is produced by our E.coli expression system and the target gene encoding Ala28-Asn100 is expressed. C-X-C motif chemokine 2 (CXCL2, MIP-2) belongs to the intercrine alpha (chemokine CxC) family. It was originally identified as a heparin-binding protein secreted from a murine macrophage cell line in response to endotoxin stimulation. The expression of mouse MIP-2 is stimulated by endotoxin. The mouse MIP-2 shares approximately 63% aa sequence identity with murine KC, another mouse alpha chemokine, which is induced by PDGF. It has been suggested that mouse KC and MIP-2 are the homologs of the human GROs and rat CINCs. Chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst. The expression of MIP-2 was found to be associated with neutrophil influx in pulmonary inflammation and glomerulonephritis, suggesting that MIP-2 may contribute to the pathogenesis of inflammatory diseases.
Product Specifications
Gene Name
Cxcl2
Gene ID
20310
UniProt
P10889
Components
Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items