Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tumor Necrosis Factor/TNFa

Source: E. coli. MW :16.4kD. Recombinant Mouse Tumor Necrosis Factor alpha is produced by our E.coli expression system and the target gene encoding Asp89-Leu235 is expressed. Tumor Necrosis Factor (TNF) is a member of the Tumor Necrosis Factor family. TNF exists as a homotrimer and interacts with SPPL2B. TNF is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. TNF is a key cytokine in the development of several inflammatory disorders. It contributes to the development of type 2 diabetes throught its effects on insulin resistance and fatty acid metabolism.

Product Specifications

Gene Name

Tnf

Gene ID

21926

UniProt

P06804

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Phoneutria nigriventer U7-ctenitoxin-Pn1a
MBS1064678-01 0.02 mg (E-Coli)

Recombinant Phoneutria nigriventer U7-ctenitoxin-Pn1a

Sign In for Pricing
View Details
Recombinant Phoneutria nigriventer U7-ctenitoxin-Pn1a
MBS1064678-02 0.1 mg (E-Coli)

Recombinant Phoneutria nigriventer U7-ctenitoxin-Pn1a

Sign In for Pricing
View Details
Recombinant Phoneutria nigriventer U7-ctenitoxin-Pn1a
MBS1064678-03 0.02 mg (Yeast)

Recombinant Phoneutria nigriventer U7-ctenitoxin-Pn1a

Sign In for Pricing
View Details
Recombinant Phoneutria nigriventer U7-ctenitoxin-Pn1a
MBS1064678-04 0.1 mg (Yeast)

Recombinant Phoneutria nigriventer U7-ctenitoxin-Pn1a

Sign In for Pricing
View Details
Recombinant Phoneutria nigriventer U7-ctenitoxin-Pn1a
MBS1064678-05 0.02 mg (Baculovirus)

Recombinant Phoneutria nigriventer U7-ctenitoxin-Pn1a

Sign In for Pricing
View Details
Recombinant Phoneutria nigriventer U7-ctenitoxin-Pn1a
MBS1064678-06 1 mg (E-Coli)

Recombinant Phoneutria nigriventer U7-ctenitoxin-Pn1a

Sign In for Pricing
View Details