Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Deoxycytidine Kinase/DCK (N-6His, T7 tag)

Source: E. coli. MW :34kD. Recombinant Human Deoxycytidine Kinase is produced by our E.coli expression system and the target gene encoding Met1-Leu260 is expressed with a 6His, T7 tag at the N-terminus. Deoxycytidine Kinase (DCK) is a member of the DCK/DGK family. DCK exists as a homodimer and is localized to the nucleus. DCK is required for the phosphorylation of the deoxyribonucleosides deoxycytidine (dC), deoxyguanosine (dG), and deoxyadenosine (dA) . DCK has broad substrate specificity, and does not display selectivity based on the chirality of the substrate. In addition, DCK is also an essential enzyme for the phosphorylation of numerous nucleoside analogs widely employed as antiviral and chemotherapeutic agents. DCK is clinically important because of its relationship to drug resistance and sensitivity.

Product Specifications

Gene Name

DCK

Gene ID

1633

UniProt

P27707

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, pH7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMATPPKRSCPSFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Sheep Regulated On Activation In Normal T-Cell Expressed and Secreted ELISA Kit
MBS014408-01 48 Well

Sheep Regulated On Activation In Normal T-Cell Expressed and Secreted ELISA Kit

Ask
View Details
Sheep Regulated On Activation In Normal T-Cell Expressed and Secreted ELISA Kit
MBS014408-02 96 Well

Sheep Regulated On Activation In Normal T-Cell Expressed and Secreted ELISA Kit

Ask
View Details
Sheep Regulated On Activation In Normal T-Cell Expressed and Secreted ELISA Kit
MBS014408-03 5x 96 Well

Sheep Regulated On Activation In Normal T-Cell Expressed and Secreted ELISA Kit

Ask
View Details
Sheep Regulated On Activation In Normal T-Cell Expressed and Secreted ELISA Kit
MBS014408-04 10x 96 Well

Sheep Regulated On Activation In Normal T-Cell Expressed and Secreted ELISA Kit

Ask
View Details
Rabbit Cardiac Troponin T autoantibody ELISA Kit
MBS7279681-01 48 Well

Rabbit Cardiac Troponin T autoantibody ELISA Kit

Ask
View Details
Rabbit Cardiac Troponin T autoantibody ELISA Kit
MBS7279681-02 96 Well

Rabbit Cardiac Troponin T autoantibody ELISA Kit

Ask
View Details