Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Deoxycytidine Kinase/DCK (N-6His, T7 tag)

Source: E. coli. MW :34kD. Recombinant Human Deoxycytidine Kinase is produced by our E.coli expression system and the target gene encoding Met1-Leu260 is expressed with a 6His, T7 tag at the N-terminus. Deoxycytidine Kinase (DCK) is a member of the DCK/DGK family. DCK exists as a homodimer and is localized to the nucleus. DCK is required for the phosphorylation of the deoxyribonucleosides deoxycytidine (dC), deoxyguanosine (dG), and deoxyadenosine (dA) . DCK has broad substrate specificity, and does not display selectivity based on the chirality of the substrate. In addition, DCK is also an essential enzyme for the phosphorylation of numerous nucleoside analogs widely employed as antiviral and chemotherapeutic agents. DCK is clinically important because of its relationship to drug resistance and sensitivity.

Product Specifications

Gene Name

DCK

Gene ID

1633

UniProt

P27707

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, pH7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMATPPKRSCPSFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Protocadherin beta-14 (PCDHB14) ELISA Kit
abx537997 96 Tests

Mouse Protocadherin beta-14 (PCDHB14) ELISA Kit

Ask
View Details
Box of 100 Mce Membranes 3,0 µm, 47 Mm
MF047ME300C Box of 100

Box of 100 Mce Membranes 3,0 µm, 47 Mm

Ask
View Details
Lentiviral mouse Cd7 shRNA (UAS) - Lentiviral mouse Cd7 shRNA (UAS, GFP) plasmid
GTR15253786 1 Vial

Lentiviral mouse Cd7 shRNA (UAS) - Lentiviral mouse Cd7 shRNA (UAS, GFP) plasmid

Ask
View Details
Btd (NM_001012047) Rat Tagged Lenti ORF Clone
RR201713L4 10 µg

Btd (NM_001012047) Rat Tagged Lenti ORF Clone

Ask
View Details
Human TNS1 siRNA
abx937704-01 15 nmol

Human TNS1 siRNA

Ask
View Details
Human TNS1 siRNA
abx937704-02 30 nmol

Human TNS1 siRNA

Ask
View Details