Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human FGF1 Intracellular-Binding Protein/FIBP

Source: E. coli. MW :41.8kD. Recombinant Human FIBP is produced by our E.coli expression system and the target gene encoding Met1-Asp357 is expressed. Acidic Fibroblast Growth Factor Intracellular-Binding Protein (FIBP) is highly expressed in the heart, skeletal muscle, and pancreas. Acidic Fibroblast Growth Factor is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FIBP is an intracellular protein that binds selectively to acidic fibroblast growth factor (aFGF) . It is postulated that FIBP may be involved in the mitogenic action of aFGF.

Product Specifications

Gene Name

FIBP

Gene ID

9158

UniProt

O43427

Components

Supplied as a 0.2 μm filtered solution of 50mM TrisHCl, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AMADIGSMTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD
More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Campylobacter fetus subsp. fetus Ribosome maturation factor RimM (rimM)
MBS1129293-01 0.02 mg (E-Coli)

Recombinant Campylobacter fetus subsp. fetus Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details
Recombinant Campylobacter fetus subsp. fetus Ribosome maturation factor RimM (rimM)
MBS1129293-02 0.1 mg (E-Coli)

Recombinant Campylobacter fetus subsp. fetus Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details
Recombinant Campylobacter fetus subsp. fetus Ribosome maturation factor RimM (rimM)
MBS1129293-03 0.02 mg (Yeast)

Recombinant Campylobacter fetus subsp. fetus Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details
Recombinant Campylobacter fetus subsp. fetus Ribosome maturation factor RimM (rimM)
MBS1129293-04 0.1 mg (Yeast)

Recombinant Campylobacter fetus subsp. fetus Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details
Recombinant Campylobacter fetus subsp. fetus Ribosome maturation factor RimM (rimM)
MBS1129293-05 0.02 mg (Baculovirus)

Recombinant Campylobacter fetus subsp. fetus Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details
Recombinant Campylobacter fetus subsp. fetus Ribosome maturation factor RimM (rimM)
MBS1129293-06 0.02 mg (Mammalian-Cell)

Recombinant Campylobacter fetus subsp. fetus Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details