Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carbonic Anhydrase 10/CA10 (N-6His)

Source: E.coli. MW :34.1kD. Recombinant Human Carbonic Anhydrase 10 is produced by our E.coli expression system and the target gene encoding Ala21-Asn300 is expressed with a 6His tag at the N-terminus. Carbonic Anhydrase-Related Protein 10 (CA10) belongs to the Carbonic Anhydrase family of Zinc Metalloenzymes. It is an acatalytic member of the alpha-carbonic anhydrase subgroup. CA10 expression is detected in the adult total brain and almost all parts of the central nervous system, but not in the fetal brain. CA10 catalyze the reversible hydration of carbon dioxide in various biological processes, which is fundamental to many processes such as respiration, renal tubular acidification and bone resorption. It is thought to play a role in the central nervous system, especially in brain development.

Product Specifications

Gene Name

CA10

Gene ID

56934

UniProt

Q9NS85

Components

Lyophilized from a 0.2 μm filtered solution of 25mM Tris, 150mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNLELQSR
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

4-[ (1R) -1,5-Dimethyl-4-hexen-1-yl]-2-cyclohexen-1-one
429779-01 5 mg

4-[ (1R) -1,5-Dimethyl-4-hexen-1-yl]-2-cyclohexen-1-one

Ask
View Details
4-[ (1R) -1,5-Dimethyl-4-hexen-1-yl]-2-cyclohexen-1-one
429779-02 25 mg

4-[ (1R) -1,5-Dimethyl-4-hexen-1-yl]-2-cyclohexen-1-one

Ask
View Details
SUMO2/3, CT (SUMO3, SMT3B, SMT3H1, Small ubiquitin-related modifier 3, SMT3 homolog 1, SUMO-2, Ubiquitin-like protein SMT3B) (MaxLight 490)
MBS6352616-01 0.1 mL

SUMO2/3, CT (SUMO3, SMT3B, SMT3H1, Small ubiquitin-related modifier 3, SMT3 homolog 1, SUMO-2, Ubiquitin-like protein SMT3B) (MaxLight 490)

Ask
View Details
SUMO2/3, CT (SUMO3, SMT3B, SMT3H1, Small ubiquitin-related modifier 3, SMT3 homolog 1, SUMO-2, Ubiquitin-like protein SMT3B) (MaxLight 490)
MBS6352616-02 5x 0.1 mL

SUMO2/3, CT (SUMO3, SMT3B, SMT3H1, Small ubiquitin-related modifier 3, SMT3 homolog 1, SUMO-2, Ubiquitin-like protein SMT3B) (MaxLight 490)

Ask
View Details
Mouse Fc Fragment of IgG Low Affinity IIIa Receptor ELISA Kit
MBS070999-01 48 Well

Mouse Fc Fragment of IgG Low Affinity IIIa Receptor ELISA Kit

Ask
View Details
Mouse Fc Fragment of IgG Low Affinity IIIa Receptor ELISA Kit
MBS070999-02 96 Well

Mouse Fc Fragment of IgG Low Affinity IIIa Receptor ELISA Kit

Ask
View Details