Recombinant Human IGF2 mRNA-Binding Protein 2/IGF2BP2/IMP2 (C-6His, N-T7 tag)

Source: E. coli. MW :27.2kD. Recombinant Human IGF2BP2 is produced by our E.coli expression system and the target gene encoding Met1-Thr220 is expressed with a T7 tag at the N-terminus, 6His tag at the C-terminus. Insulin-Like Growth Factor 2 mRNA-Binding Protein 2 (IGFBP2) belongs to the RRM IMP/VICKZ family. IGFBP2 is a cytoplasmic protein and contains four KH domains and two RRM (RNA recognition motif) domains. IGF2BP2 binds to the 5'-UTR of the Insulin-Like Growth Factor 2 (IGF2) mRNA. This binding is isoform-specific. IGF2BP2 may regulate translation of target mRNAs. Genetic variation at the IGF2BP2 gene has been associated with type 2 diabetes (T2D) by genome-wide association studies and by replication analyses.

Product Specifications

Gene Name

IGF2BP2

Gene ID

10644

UniProt

Q9Y6M1

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MASMTGGQQMGRGSEFMMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITLEHHHHHH