Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfotransferase 1A2/SULT1A2 (N-6His)

Source: E. coli. MW :36.4kD. Recombinant Human Sulfotransferase 1A2 is produced by our E.coli expression system and the target gene encoding Met1-Leu295 is expressed with a 6His tag at the N-terminus. Sulfotransferase 1A2 (SULT1A2) is a member of the Sulfotransferase 1 family. Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. SULT1A2 is a cytoplasmic protein and exists as a homodimer. SULT1A2 mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and might thus participate as a modulating factor of cancer risk.

Product Specifications

Gene Name

SULT1A2

Gene ID

6799

UniProt

P50226

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TUSC5, ID (TUSC5, IFITMD3, LOST1, Tumor suppressor candidate 5, Dispanin subfamily B member 1, Interferon-induced transmembrane domain-containing protein D3, Protein located at seventeen-p-thirteen point three 1) (MaxLight 405) discontinued
043472-ML405 100 µL

TUSC5, ID (TUSC5, IFITMD3, LOST1, Tumor suppressor candidate 5, Dispanin subfamily B member 1, Interferon-induced transmembrane domain-containing protein D3, Protein located at seventeen-p-thirteen point three 1) (MaxLight 405) discontinued

Ask
View Details
C4ORF28 (PACRGL) Human qPCR Primer Pair (AK098692)
HP222773 200 Reactions

C4ORF28 (PACRGL) Human qPCR Primer Pair (AK098692)

Ask
View Details
Recombinant Mouse Transmembrane 7 superfamily member 4 (Tm7sf4), partial
MBS7057318 Inquire

Recombinant Mouse Transmembrane 7 superfamily member 4 (Tm7sf4), partial

Ask
View Details
Anti-red cell Antibody Mouse ELISA Kit
20035 96 Tests

Anti-red cell Antibody Mouse ELISA Kit

Ask
View Details
Canine soluble adhesion molecules (Sam) ELISA Kit
MBS2604779-01 48 Well

Canine soluble adhesion molecules (Sam) ELISA Kit

Ask
View Details
Canine soluble adhesion molecules (Sam) ELISA Kit
MBS2604779-02 96 Well

Canine soluble adhesion molecules (Sam) ELISA Kit

Ask
View Details