Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfotransferase 1A2/SULT1A2 (N-6His)

Source: E. coli. MW :36.4kD. Recombinant Human Sulfotransferase 1A2 is produced by our E.coli expression system and the target gene encoding Met1-Leu295 is expressed with a 6His tag at the N-terminus. Sulfotransferase 1A2 (SULT1A2) is a member of the Sulfotransferase 1 family. Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. SULT1A2 is a cytoplasmic protein and exists as a homodimer. SULT1A2 mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and might thus participate as a modulating factor of cancer risk.

Product Specifications

Gene Name

SULT1A2

Gene ID

6799

UniProt

P50226

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Mouse Male-specific lethal 3 homolog (Msl3)
MBS1415381-01 0.02 mg (E-Coli)

Recombinant Mouse Male-specific lethal 3 homolog (Msl3)

Ask
View Details
Recombinant Mouse Male-specific lethal 3 homolog (Msl3)
MBS1415381-02 0.02 mg (Yeast)

Recombinant Mouse Male-specific lethal 3 homolog (Msl3)

Ask
View Details
Recombinant Mouse Male-specific lethal 3 homolog (Msl3)
MBS1415381-03 0.1 mg (E-Coli)

Recombinant Mouse Male-specific lethal 3 homolog (Msl3)

Ask
View Details
Recombinant Mouse Male-specific lethal 3 homolog (Msl3)
MBS1415381-04 0.1 mg (Yeast)

Recombinant Mouse Male-specific lethal 3 homolog (Msl3)

Ask
View Details
Recombinant Mouse Male-specific lethal 3 homolog (Msl3)
MBS1415381-05 0.02 mg (Baculovirus)

Recombinant Mouse Male-specific lethal 3 homolog (Msl3)

Ask
View Details
Recombinant Mouse Male-specific lethal 3 homolog (Msl3)
MBS1415381-06 0.02 mg (Mammalian-Cell)

Recombinant Mouse Male-specific lethal 3 homolog (Msl3)

Ask
View Details