Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galectin-Related Protein/LGALSL (C-6His)

Source: E. coli. MW :20kD. Recombinant Human Galectin-Related Protein is produced by our E.coli expression system and the target gene encoding Ala2-Ser172 is expressed with a 6His tag at the C-terminus. Galectin-Related Protein (LGALSL) is a 172 amino acid protein that contains one Galectin domain. LGALSL does not appear to bind carbohydrates or lactose as the critical residues required for binding are not conserved. LGALSL may play a significant role in stimulating smooth muscle growth in developing alveolar wall vessels and the development of pulmonary capillaries.

Product Specifications

Gene Name

LGALSL

Gene ID

29094

UniProt

Q3ZCW2

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLGLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CYP11B2 Over-expression Lysate Product
GWB-CB75BA 0.1 mg

CYP11B2 Over-expression Lysate Product

Ask
View Details
SH-4-54 100mg
A14249-100 100 mg

SH-4-54 100mg

Ask
View Details
Gab1 CT (Grb2-Associated Binder1) (FITC)
MBS6477330-01 0.1 mL

Gab1 CT (Grb2-Associated Binder1) (FITC)

Ask
View Details
Gab1 CT (Grb2-Associated Binder1) (FITC)
MBS6477330-02 5x 0.1 mL

Gab1 CT (Grb2-Associated Binder1) (FITC)

Ask
View Details
Monkey Inter Alpha-Globulin Inhibitor H3 ELISA Kit
MBS075870-01 48 Well

Monkey Inter Alpha-Globulin Inhibitor H3 ELISA Kit

Ask
View Details
Monkey Inter Alpha-Globulin Inhibitor H3 ELISA Kit
MBS075870-02 96 Well

Monkey Inter Alpha-Globulin Inhibitor H3 ELISA Kit

Ask
View Details