Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 a/MAP1LC3A (C-6His)

Source: E. coli. MW :15.3kD. Recombinant Human MAP1LC3A is produced by our E.coli expression system and the target gene encoding Met1-Phe121 is expressed with a 6His tag at the C-terminus. Microtubule-Associated Proteins 1A/1B Light Chain 3A (MAP1LC3A) belongs to the MAP1 LC3 family. MAP1LC3A is found most abundantly in the heart, brain, liver, skeletal muscle, and testis. But it is absent in the thymus and peripheral blood leukocytes. MAP1LC3A is thought to take part in the formation of autophagosomal vacuoles and is one of the light chain subunits that functions together with both MAP1A and/or MAP1B. In addition, MAP1A has an important part in neuronal development and in maintaining the balance between neuronal plasticity and rigidity.

Product Specifications

Gene Name

MAP1LC3A

Gene ID

84557

UniProt

Q9H492

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 20% Glycerol, 0.1M NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGFLEHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Plekhh1 Pre-designed siRNA Set A
SI210655A 1 Each

Rat Plekhh1 Pre-designed siRNA Set A

Ask
View Details
HA Protein (C-His, H1N1)
P519684 100 µg

HA Protein (C-His, H1N1)

Ask
View Details
Gellan Gum discontinued. See 396822
297159-01 250 g

Gellan Gum discontinued. See 396822

Ask
View Details
Gellan Gum discontinued. See 396822
297159-02 500 g

Gellan Gum discontinued. See 396822

Ask
View Details
Gellan Gum discontinued. See 396822
297159-03 1 Kg

Gellan Gum discontinued. See 396822

Ask
View Details
NEK8 Rabbit Polyclonal Antibody
E53P12698 100 µL

NEK8 Rabbit Polyclonal Antibody

Ask
View Details