Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thioredoxin/TXN (N-6His)

Source: E. coli. MW :13.9kD. Recombinant Human Thioredoxin is produced by our E.coli expression system and the target gene encoding Met1-Val105 is expressed with a 6His tag at the N-terminus. Thioredoxin (TXN) is a member of the Thioredoxin family. Thioredoxin exists as a disulfide-linked homodimer and contains one Thioredoxin domain. Thioredoxin is up-regulated by ionizing radiation. Thioredoxin participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Thioredoxin also plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide.

Product Specifications

Gene Name

TXN

Gene ID

7295

UniProt

P10599

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, PH7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mmu-miR-698-5p miRNA Antagomir
CIN1126-01 10 nmol

Mmu-miR-698-5p miRNA Antagomir

Ask
View Details
Mmu-miR-698-5p miRNA Antagomir
CIN1126-02 20 nmol

Mmu-miR-698-5p miRNA Antagomir

Ask
View Details
Mouse Monoclonal CD42b/GPIb alpha Antibody (HIP1) [Alexa Fluor 532]
NB500-511AF532 0.1 mL

Mouse Monoclonal CD42b/GPIb alpha Antibody (HIP1) [Alexa Fluor 532]

Ask
View Details
Protein Phosphatase 1 Regulatory Subunit 11 Polyclonal Conjugated Antibody
MBS9450814-01 0.1 mL (Biotin)

Protein Phosphatase 1 Regulatory Subunit 11 Polyclonal Conjugated Antibody

Ask
View Details
Protein Phosphatase 1 Regulatory Subunit 11 Polyclonal Conjugated Antibody
MBS9450814-02 0.1 mL (AF350)

Protein Phosphatase 1 Regulatory Subunit 11 Polyclonal Conjugated Antibody

Ask
View Details
Protein Phosphatase 1 Regulatory Subunit 11 Polyclonal Conjugated Antibody
MBS9450814-03 0.1 mL (AF405)

Protein Phosphatase 1 Regulatory Subunit 11 Polyclonal Conjugated Antibody

Ask
View Details