Recombinant Human Group XVI Phospholipase A1/A2/PLA2G16 (N-6His)
Source: E.coli. MW :15.93kD. Recombinant Human PLA2G16 is produced by our E.coli expression system and the target gene encoding Asp12-Asp132 is expressed with a 6His tag at the N-terminus. Group XVI Phospholipase A1/A2 (PLA2G16) belongs to the H-rev 107 family. PLA2G16 is expressed in a number of human tumors including ovarian carcinomas, lung carcinomas. PLA2G16 is involved in the regulation of differentiation and survival. PLA2G16 regulates adipocyte lipolysis and release of fatty acids through a G-protein coupled pathway involving prostaglandin and EP3. It has also been reported to play a crucial role in the development of obesity in mouse models.
Product Specifications
Gene Name
PLA2G16
Gene ID
11145
UniProt
P53816
Components
Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, pH 8.0.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MGSSHHHHHHSSGLVPRGSHMDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRD
Explore Other Products
Browse additional items from our catalog