Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Group XVI Phospholipase A1/A2/PLA2G16 (N-6His)

Source: E.coli. MW :15.93kD. Recombinant Human PLA2G16 is produced by our E.coli expression system and the target gene encoding Asp12-Asp132 is expressed with a 6His tag at the N-terminus. Group XVI Phospholipase A1/A2 (PLA2G16) belongs to the H-rev 107 family. PLA2G16 is expressed in a number of human tumors including ovarian carcinomas, lung carcinomas. PLA2G16 is involved in the regulation of differentiation and survival. PLA2G16 regulates adipocyte lipolysis and release of fatty acids through a G-protein coupled pathway involving prostaglandin and EP3. It has also been reported to play a crucial role in the development of obesity in mouse models.

Product Specifications

Gene Name

PLA2G16

Gene ID

11145

UniProt

P53816

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRD

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-VAV1  (2C11)
YF-MA16042 100 ug

Anti-VAV1 (2C11)

Sign In for Pricing
View Details
CPLX3, ID (CPLX3, Complexin-3, Complexin III) (MaxLight 490) discontinued
034165-ML490 100 µL

CPLX3, ID (CPLX3, Complexin-3, Complexin III) (MaxLight 490) discontinued

Sign In for Pricing
View Details
SAM68 Recombinant Antibody, PE Conjugated
bsm-62862R-PE-01 20 µL

SAM68 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
SAM68 Recombinant Antibody, PE Conjugated
bsm-62862R-PE-02 100 µL

SAM68 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
MTUS1 Rabbit Polyclonal Antibody (N-Term)
E28PB3586 100 µL

MTUS1 Rabbit Polyclonal Antibody (N-Term)

Sign In for Pricing
View Details
AP4A – Solid (25 mg)
JBS-NU-507-25 25 mg

AP4A – Solid (25 mg)

Sign In for Pricing
View Details