Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Group XVI Phospholipase A1/A2/PLA2G16 (N-6His)

Source: E.coli. MW :15.93kD. Recombinant Human PLA2G16 is produced by our E.coli expression system and the target gene encoding Asp12-Asp132 is expressed with a 6His tag at the N-terminus. Group XVI Phospholipase A1/A2 (PLA2G16) belongs to the H-rev 107 family. PLA2G16 is expressed in a number of human tumors including ovarian carcinomas, lung carcinomas. PLA2G16 is involved in the regulation of differentiation and survival. PLA2G16 regulates adipocyte lipolysis and release of fatty acids through a G-protein coupled pathway involving prostaglandin and EP3. It has also been reported to play a crucial role in the development of obesity in mouse models.

Product Specifications

Gene Name

PLA2G16

Gene ID

11145

UniProt

P53816

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRD

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

METTL3 Knockout DLD-1 Polyclonal Cells
ARG12061 1 Million

METTL3 Knockout DLD-1 Polyclonal Cells

Ask
View Details
Recombinant Vibrio cholerae serotype O1 Bifunctional protein GlmU (glmU)
MBS1290325-01 0.02 mg (E-Coli)

Recombinant Vibrio cholerae serotype O1 Bifunctional protein GlmU (glmU)

Ask
View Details
Recombinant Vibrio cholerae serotype O1 Bifunctional protein GlmU (glmU)
MBS1290325-02 0.02 mg (Yeast)

Recombinant Vibrio cholerae serotype O1 Bifunctional protein GlmU (glmU)

Ask
View Details
Recombinant Vibrio cholerae serotype O1 Bifunctional protein GlmU (glmU)
MBS1290325-03 0.1 mg (E-Coli)

Recombinant Vibrio cholerae serotype O1 Bifunctional protein GlmU (glmU)

Ask
View Details
Recombinant Vibrio cholerae serotype O1 Bifunctional protein GlmU (glmU)
MBS1290325-04 0.1 mg (Yeast)

Recombinant Vibrio cholerae serotype O1 Bifunctional protein GlmU (glmU)

Ask
View Details
Recombinant Vibrio cholerae serotype O1 Bifunctional protein GlmU (glmU)
MBS1290325-05 0.02 mg (Baculovirus)

Recombinant Vibrio cholerae serotype O1 Bifunctional protein GlmU (glmU)

Ask
View Details