Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein Phosphatase 1C Catalytic Subunit/PPP1CC (N, C-6His)

Source: E.coli. MW :40.2kD. Recombinant Human PPP1CC is produced by our E.coli expression system and the target gene encoding Met1-Lys323 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. Serine/Threonine-Protein Phosphatase PP1-? Catalytic Subunit (PPP1CC) is a member of the PPP phosphatase family. It is essential for cell division, participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. PPP1CC colocalizes with SPZ1 in the nucleus, with URI1 at mitochondrion, Rapidly exchanges between the nucleolar, nucleoplasmic and cytoplasmic compartments. As a cofactor, PPP1CC binds one iron ion and one manganese ion per subunit.. In addition, PPP1CC may play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II.

Product Specifications

Gene Name

PPP1CC

Gene ID

5501

UniProt

P36873

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0 .

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKKLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Piccolo Recombinant Protein Antigen
NBP1-90251PEP 0.1 mL

Piccolo Recombinant Protein Antigen

Ask
View Details
NFIA, CT (NFIA, KIAA1439, Nuclear factor 1 A-type, CCAAT-box-binding transcription factor, Nuclear factor I/A, TGGCA-binding protein) (FITC)
MBS6324996-01 0.2 mL

NFIA, CT (NFIA, KIAA1439, Nuclear factor 1 A-type, CCAAT-box-binding transcription factor, Nuclear factor I/A, TGGCA-binding protein) (FITC)

Ask
View Details
NFIA, CT (NFIA, KIAA1439, Nuclear factor 1 A-type, CCAAT-box-binding transcription factor, Nuclear factor I/A, TGGCA-binding protein) (FITC)
MBS6324996-02 5x 0.2 mL

NFIA, CT (NFIA, KIAA1439, Nuclear factor 1 A-type, CCAAT-box-binding transcription factor, Nuclear factor I/A, TGGCA-binding protein) (FITC)

Ask
View Details
CENPBD1 Antibody - N-terminal region
MBS3218346-01 0.1 mL

CENPBD1 Antibody - N-terminal region

Ask
View Details
CENPBD1 Antibody - N-terminal region
MBS3218346-02 5x 0.1 mL

CENPBD1 Antibody - N-terminal region

Ask
View Details
Mycobacterium tuberculosis, 38kD (PE) discontinued
M9699-74A-PE 100 µL

Mycobacterium tuberculosis, 38kD (PE) discontinued

Ask
View Details