Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein Phosphatase 1C Catalytic Subunit/PPP1CC (N, C-6His)

Source: E.coli. MW :40.2kD. Recombinant Human PPP1CC is produced by our E.coli expression system and the target gene encoding Met1-Lys323 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. Serine/Threonine-Protein Phosphatase PP1-? Catalytic Subunit (PPP1CC) is a member of the PPP phosphatase family. It is essential for cell division, participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. PPP1CC colocalizes with SPZ1 in the nucleus, with URI1 at mitochondrion, Rapidly exchanges between the nucleolar, nucleoplasmic and cytoplasmic compartments. As a cofactor, PPP1CC binds one iron ion and one manganese ion per subunit.. In addition, PPP1CC may play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II.

Product Specifications

Gene Name

PPP1CC

Gene ID

5501

UniProt

P36873

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0 .

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKKLEHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Bmp2 (NM_017178) Rat Tagged Lenti ORF Clone
RR201404L3 10 µg

Bmp2 (NM_017178) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse H2-K1 shRNA (UAS) - Lentiviral mouse H2-K1 shRNA (UAS, GFP) plasmid
GTR15302857 1 Vial

Lentiviral mouse H2-K1 shRNA (UAS) - Lentiviral mouse H2-K1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
ROPN1L CRISPRa sgRNA lentivector (set of three targets)(Human)
40684121 3x 1.0µg DNA

ROPN1L CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
OriCell™ Complete Medium For IPEC-J2 Cell Line
CMP1-0101 500 mL

OriCell™ Complete Medium For IPEC-J2 Cell Line

Sign In for Pricing
View Details
Human C-X-C Motif Chemokine 3 (CXCL3) Protein
abx066969-01 10 µg

Human C-X-C Motif Chemokine 3 (CXCL3) Protein

Sign In for Pricing
View Details
Human C-X-C Motif Chemokine 3 (CXCL3) Protein
abx066969-02 50 µg

Human C-X-C Motif Chemokine 3 (CXCL3) Protein

Sign In for Pricing
View Details